Skip to main content

Protein Molecular Weight Calculator

This protein molecular weight calculator determines the mass of a protein (in Daltons and kilodaltons) from its amino acid sequence. Paste one-letter or three-letter residue codes, specify disulfide bonds, and optionally convert a molar amount into micrograms or milligrams.

One-letter amino acid codes, with or without spaces. FASTA headers are stripped automatically, three-letter codes are accepted, and chains are separated by "/" or ";".

Average mass uses IUPAC standard atomic weights; monoisotopic uses the lightest stable isotope of each element.

Number of S-S bridges. Each removes 2.01565 Da (two hydrogen atoms). Leave blank to assume every pair of cysteines forms a bridge, which is right for a secreted or oxidised protein.

Molar amount to convert into mass, or mass to convert into moles. Leave blank to skip.

Unit for the amount field. Choose mg to reverse-convert mass into moles.

What Is the Protein Molecular Weight Calculator?

Protein molecular weight — often abbreviated as MW and expressed in Daltons (Da) or kilodaltons (kDa) — is the sum of the atomic masses of every atom in a polypeptide chain. It is one of the most fundamental physical properties used in biochemistry, structural biology, and proteomics.

Knowing the molecular weight of a protein is essential for designing SDS-PAGE gels, interpreting mass spectrometry data, calculating molar concentrations from spectrophotometric absorbance readings, and determining stoichiometric ratios in binding assays.

The mass a protein has is not a rounding of its sequence length. Two proteins of the same residue count can differ by tens of kilodaltons, because tryptophan alone contributes 204.23 Da per residue and leucine only 113.16 Da, while a glycine residue adds 57.02 Da. Sequence order changes nothing: only the composition, the chain count and the bridges between chains move the number.

How Does the Protein Molecular Weight Calculator Work?

The calculator sums the molar mass of each free amino acid in the sequence. Each peptide bond is formed by a condensation reaction that releases one water molecule (18.01528 Da on average atomic weights, 18.010565 Da monoisotopic). A chain of n residues has n - 1 peptide bonds, and c chains joined only by peptide bonds have n - c bonds in total.

If the protein contains disulfide bridges (S-S bonds between cysteine residues), each bridge removes two hydrogen atoms (2.01565 Da). The final molecular weight is: MW = sum(n_i x m_i) - (N - c) x 18.01528 - b x 2.01565. Two chains of 21 and 30 residues share 49 peptide bonds rather than 50, which is where most hand calculations slip.

The extinction coefficient at 280 nm is calculated using the Pace convention: ε₂₈₀ = 5,500 × nTrp + 1,490 × nTyr + 125 × nCys-free, in M⁻¹ cm⁻¹. This value is used by UV spectrophotometers to estimate protein concentration via the Beer-Lambert law.

Protein Molecular Weight Calculator Formula & Variables

The core mathematical equation utilized by this calculator is expressed as:

MW=∑ini mi−(N−c) 18.01528−b×2.01565kDa=MW1000ε280=5500 nTrp+1490 nTyr+125 nCys,free\mathrm{MW} = \sum_i n_i\, m_i - (N - c)\, 18.01528 - b \times 2.01565 \\ \mathrm{kDa} = \frac{\mathrm{MW}}{1000} \\ \varepsilon_{280} = 5500\, n_{\mathrm{Trp}} + 1490\, n_{\mathrm{Tyr}} + 125\, n_{\mathrm{Cys,free}}

Variable Definitions

SymbolVariable Meaning & Units
nin_iCount of residue i in the sequence
mim_iMolar mass of free amino acid i (Da)
N - cTotal peptide bonds (residues minus chains)
18.01528Mass of one water molecule lost per peptide bond (average, Da)
bNumber of disulfide bridges
2.01565Mass of two hydrogen atoms lost per disulfide bridge (Da)

A protein is a chain of amino acids joined by peptide bonds. Each bond is a condensation step that releases one water molecule. The mass is the sum of the free amino acid masses minus one water for every peptide bond. Disulfide bridges remove a further two hydrogen atoms each. The extinction coefficient at 280 nm counts the aromatic residues that absorb UV light: tryptophan (5,500 M⁻¹cm⁻¹), tyrosine (1,490 M⁻¹cm⁻¹), and each free cysteine (125 M⁻¹cm⁻¹).

How to Use the Protein Molecular Weight Calculator

  1. Paste your protein sequence in one-letter amino acid codes (e.g., MKTAYIAKQRQ). FASTA headers starting with ">" are automatically stripped.
  2. Choose between average mass (standard atomic weights, suitable for most biochemistry) or monoisotopic mass (lightest stable isotope, used in mass spectrometry).
  3. Enter the number of disulfide bonds, or leave blank to assume every pair of cysteines forms a bridge.
  4. Optionally enter a molar amount (pmol, nmol, µmol) to calculate the corresponding mass in µg or mg, or enter mg to convert back to moles.

Step-by-Step Example Calculation

Two-chain bovine insulin, with its three disulfide bridges

Input Values:

sequence:GIVEQCCTSICSLYQLENYCN/FVNQHLCGSHLVEALYLVCGERGFFYTPKT
massType:average
disulfideBonds:3
amount:500
amountUnit:pmol
Worked Steps: The 21-residue A chain and 30-residue B chain are separated by a slash, so they are treated as two chains: 51 residues make 49 peptide bonds. The free amino acids sum to 6,696.42 Da, the 49 waters cost 49 x 18.01528 = 882.749 Da, and the three S-S bridges cost 3 x 2.01565 = 6.047 Da. That leaves 5,807.62 Da, the accepted 5.81 kDa for insulin. Six cysteines are all paired, so none is left as a free thiol and the extinction coefficient is 1,490 x 4 Tyr = 5,960 M^-1 cm^-1. The same molecule in monoisotopic terms is 5,803.64 Da.

Understanding Your Result

Molecular Weight (Da / kDa): The calculated mass of the entire protein or complex. 1 kDa = 1,000 Da.

Extinction Coefficient at 280 nm (M⁻¹ cm⁻¹): How strongly the protein absorbs UV light at 280 nm. Divide the measured absorbance (A₂₈₀) by this coefficient to get the molar concentration.

Residue Composition Table: the count, mass contribution and share of the joined residue mass for each amino acid type, sorted by mass.

Amount Conversion: If an amount was entered, the result shows the equivalent mass (moles → µg/mg) or moles (mg → µmol).

Factors That Affect the Result

  • Post-translational modifications: Glycosylation, phosphorylation, acetylation, ubiquitination, and lipid anchoring all add mass that cannot be predicted from the sequence alone.
  • Disulfide bonds: each S-S bridge subtracts 2.01565 Da. Antibodies have many of them, which is why an IgG heavy chain pair lands well below the sum of its free residues.
  • Mass type: Average masses are suitable for weighing, gel estimation, and centrifugation; monoisotopic masses are needed for high-resolution mass spectrometry peak assignment.

When Should You Use This Calculator?

  • SDS-PAGE gel design: Choose an appropriate acrylamide percentage and molecular weight marker ladder.
  • Mass spectrometry experiment planning: Predict intact-mass peaks and verify peptide fragment masses after tryptic digestion.
  • Spectrophotometric protein quantitation: Combine the extinction coefficient with A₂₈₀ readings to calculate molar concentrations without a Bradford or BCA assay.
  • Reagent preparation: Convert between molar amounts (nmol, µmol) and mass (µg, mg) for reconstituting lyophilised proteins.

Assumptions & Limitations

  • Assumes standard, unmodified amino acids. Post-translational modifications are not accounted for.
  • The extinction coefficient formula assumes all non-bridged cysteines are reduced; oxidized cysteines contribute differently.
  • Ambiguity codes (B, Z, J, X) use the arithmetic mean of the possible residues, introducing small uncertainty.

Frequently Asked Questions

Calculation Accuracy & Reference Note

Amino acid masses follow IUPAC 2021 standard atomic weights for average mass and NIST monoisotopic values for the lightest stable isotope. Extinction coefficients follow the Pace et al. (1995) convention used by ExPASy ProtParam and Thermo Fisher.

Standard Reference: IUPAC 2021 Standard Atomic Weights; Pace, C.N. et al. (1995) Protein Sci. 4:2411-2423; ExPASy ProtParam Tool.